CacheBy
Atlas Antibodies Anti-FPR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FPR1 Antibody

상품 한눈에 보기

Human FPR1을 표적으로 하는 Rabbit Polyclonal Antibody. IHC 등 다양한 응용에 적합하며, PrEST 항원을 이용한 친화 정제 방식으로 고순도 확보. PBS 및 glycerol buffer로 안정화된 형태로 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046550-100 Anti-FPR1 Antibody, formyl peptide receptor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046550-25 Anti-FPR1 Antibody, formyl peptide receptor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FPR1 Antibody

Anti-FPR1 Antibody

Target: Formyl peptide receptor 1 (FPR1)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human FPR1.

Alternative Gene Names

  • FMLP
  • FPR

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein Formyl peptide receptor 1
Target Gene FPR1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000045551 (61%), Rat ENSRNOG00000011174 (49%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

TTVPGKTGTVACTFNFSPWTNDPKERINVAVAMLT

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.