CacheBy
Atlas Antibodies Anti-FOXRED2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FOXRED2 Antibody

상품 한눈에 보기

인간 FOXRED2 단백질을 인식하는 토끼 폴리클로날 항체. 면역조직화학(IHC) 및 재조합 발현 기반 Western blot 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. FOXRED2 유전자 연구용에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA031612-100 Anti-FOXRED2 Antibody, FAD-dependent oxidoreductase domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031612-25 Anti-FOXRED2 Antibody, FAD-dependent oxidoreductase domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FOXRED2 Antibody

Anti-FOXRED2 Antibody

FAD-dependent oxidoreductase domain containing 2


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody against Human FOXRED2


Alternative Gene Names

  • FLJ23322

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein FAD-dependent oxidoreductase domain containing 2
Target Gene FOXRED2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CVLGAGPAGLQMAYFLQRAGRDYAVFERAPRPGSFFTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLLSHDPRLLFRHYSRAYFPDARDMVRYLGDFADTLGLRVQYNTTIAHVTLDKDRQAWNGHYFILTDQKG

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000016552 (87%)
  • Rat ENSRNOG00000005749 (87%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Application
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.