CacheBy
Atlas Antibodies Anti-FOXA2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-FOXA2 Antibody

상품 한눈에 보기

Human FOXA2 단백질을 인식하는 토끼 폴리클로날 항체로, 면역형광(ICC) 등 다양한 응용에 적합합니다. HNF3B로도 알려진 FOXA2 단백질 검출에 사용되며, PrEST 항원을 이용해 친화 정제되었습니다. 글리세롤 기반 완충용액에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066846-100 Anti-FOXA2 Antibody, forkhead box A2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066846-25 Anti-FOXA2 Antibody, forkhead box A2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-FOXA2 Antibody

Anti-FOXA2 Antibody

Target Information

  • Target Protein: forkhead box A2
  • Target Gene: FOXA2
  • Alternative Gene Names: HNF3B

Product Description

Polyclonal antibody against human FOXA2 (forkhead box A2).

  • Immunocytochemistry (ICC)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
SHHHHQPHKMDLKAYEQVMHYPGYGSPMPGSLAMGPVTNKTGLDASPLAADTS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse (ENSMUSG00000037025): 96%
  • Rat (ENSRNOG00000013133): 94%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.