Atlas Antibodies Anti-FMNL1 Antibody

상품 한눈에 보기

인간 FMNL1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반의 정교한 직교 검증 수행. 고순도 친화 정제 방식으로 제조되어 높은 특이성과 재현성 제공.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA028288-100 Anti-FMNL1 Antibody, formin-like 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA028288-25 Anti-FMNL1 Antibody, formin-like 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: formin-like 1 (FMNL1)
Host: Rabbit
Clonality: Polyclonal
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal antibody against human FMNL1.

C17orf1, C17orf1B, FMNL

항목	내용
Target Protein	formin-like 1
Target Gene	FMNL1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LHYLVKVIAEKYPQLTGFHSDLHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADSKTAQEAFESVVEYFGENPKTTSPGLFFSLFS
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000055805 (96%), Rat ENSRNOG00000003207 (96%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.