Atlas Antibodies Anti-FLNB Antibody

상품 한눈에 보기

인간 FLNB 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. RNA-seq 데이터 기반 Orthogonal 검증 완료. 고순도 Affinity 정제 방식으로 제조. 인간, 마우스, 랫트 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA004747-100 Anti-FLNB Antibody, filamin B, beta 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA004747-25 Anti-FLNB Antibody, filamin B, beta 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: filamin B, beta (FLNB)

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human FLNB

ABP-278, FH1, FLN1L, LRS1, TABP, TAP

항목	내용
Target Protein	filamin B, beta
Target Gene	FLNB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	KEPGEYAVHIMCDDEDIKDSPYMAFIHPATGGYNPDLVRAYGPGLEKSGCIVNNLAEFTVDPKDAGKAPLKIFAQDGEGQRIDIQMKNRMDGTYACSYTPVKAIKHTIAVVWG
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Mouse ENSMUSG00000025278 (90%), Rat ENSRNOG00000009470 (89%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.