CacheBy
Atlas Antibodies Anti-TMOD1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMOD1 Antibody

상품 한눈에 보기

Human TMOD1 단백질을 인식하는 rabbit polyclonal 항체로, IHC를 통한 단백질 발현 검증에 적합합니다. Orthogonal validation으로 RNA-seq 데이터와 비교 검증되었으며, 높은 종간 보존성을 보입니다. Affinity purification 방식으로 제조되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051202-100 Anti-TMOD1 Antibody, tropomodulin 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051202-25 Anti-TMOD1 Antibody, tropomodulin 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMOD1 Antibody

Anti-TMOD1 Antibody

Target Protein: tropomodulin 1
Supplier: Atlas Antibodies


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody against Human TMOD1.


Alternative Gene Names

D9S57E, ETMOD, TMOD

Open Datasheet


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    MSNQQYYQALSSSSIMNKEGLNSVIKPTQYK

Species Reactivity

  • Verified Species: Human
  • Interspecies Information:
    Highest antigen sequence identity to the following orthologs:
    • Rat ENSRNOG00000009761 (94%)
    • Mouse ENSMUSG00000028328 (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.