CacheBy
Atlas Antibodies Anti-TMIGD2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMIGD2 Antibody

상품 한눈에 보기

Human TMIGD2 단백질을 인식하는 rabbit polyclonal 항체. IHC 및 WB(재조합 발현) 검증 완료. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. 다양한 연구에서 TMIGD2 단백질 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA011081-100 Anti-TMIGD2 Antibody, transmembrane and immunoglobulin domain containing 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA011081-25 Anti-TMIGD2 Antibody, transmembrane and immunoglobulin domain containing 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMIGD2 Antibody

Anti-TMIGD2 Antibody

Target: transmembrane and immunoglobulin domain containing 2 (TMIGD2)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – validated using recombinant expression
    Recombinant expression validation in WB using target protein overexpression.

Product Description

Polyclonal antibody against Human TMIGD2.


Alternative Gene Names

  • MGC23244

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane and immunoglobulin domain containing 2
Target Gene TMIGD2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence CQVDQATAWERLRVKWTKDGAILCQPYITNGSLSLGVCGPQGRLSWQAPSHLTLQLDPVSLNHSGAYVCWAAVEIPELEEAEGNITRLFVDPDDPTQNRNRIA
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000024000 (23%), Mouse ENSMUSG00000062991 (23%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.