CacheBy
Atlas Antibodies Anti-TMEM8A Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM8A Antibody

상품 한눈에 보기

Human TMEM8A 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 등 다양한 응용에 적합함. Rabbit 유래 IgG이며 PrEST 항원으로 친화 정제됨. 인간에 대해 검증된 반응성을 가지며 TMEM8A 연구에 유용함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051281-100 Anti-TMEM8A Antibody, transmembrane protein 8A 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051281-25 Anti-TMEM8A Antibody, transmembrane protein 8A 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM8A Antibody

Anti-TMEM8A Antibody

Target Information

  • Target Protein: Transmembrane protein 8A
  • Target Gene: TMEM8A
  • Alternative Gene Names: M83, TMEM6, TMEM8
  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human TMEM8A.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
TCAYVFQPELLVTRVVEISIMEPDVPLPQTLLSHPSYLKVFVPDYTRELLLELRDCVSNGSLGCPVRLTVGPVTLPSNFQKVL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000020374 (75%)
  • Mouse ENSMUSG00000024180 (73%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.