CacheBy
Atlas Antibodies Anti-TMEM63B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM63B Antibody

상품 한눈에 보기

Human TMEM63B를 인식하는 rabbit polyclonal antibody로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 항원 서열 일치도를 보임. 40% glycerol/PBS buffer로 안정화되어 장기 보관 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA029250-100 Anti-TMEM63B Antibody, transmembrane protein 63B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA029250-25 Anti-TMEM63B Antibody, transmembrane protein 63B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM63B Antibody

Anti-TMEM63B Antibody

Target: Transmembrane protein 63B (TMEM63B)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against human TMEM63B.

Alternative Gene Names

C6orf110, dJ421H19.2, DKFZp434P0531

Open Datasheet

Target Information

항목 내용
Target Protein Transmembrane protein 63B
Target Gene TMEM63B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000036026 (100%), Rat ENSRNOG00000019743 (100%)

Antigen Sequence:
RTLFINGISKYAESEKIKKHFEEAYPNCTVLEARPCYNVARLMFLDAERKKAERGKLYFTN

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.