CacheBy
Atlas Antibodies Anti-TMEM54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM54 Antibody

상품 한눈에 보기

Human TMEM54 단백질을 인식하는 토끼 폴리클로날 항체로, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 인체 반응성이 검증되었습니다. 글리세롤 함유 완충액으로 안정하게 보관 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA061992-100 Anti-TMEM54 Antibody, transmembrane protein 54 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA061992-25 Anti-TMEM54 Antibody, transmembrane protein 54 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM54 Antibody

Anti-TMEM54 Antibody

Target Information

  • Target Protein: Transmembrane protein 54
  • Target Gene: TMEM54
  • Alternative Gene Name: CAC-1

Product Description

Polyclonal antibody against human TMEM54.

  • Immunocytochemistry (ICC)

Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence: IAMTFATQGKALLAACTFGSSELLALAPDCPFD

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028786 76%
Rat ENSRNOG00000024259 73%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.