CacheBy
Atlas Antibodies Anti-TMEM219 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM219 Antibody

상품 한눈에 보기

Human TMEM219 단백질을 표적으로 하는 폴리클로날 항체. Rabbit에서 생산된 IgG 형식으로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성 확보. Human 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA059185-100 Anti-TMEM219 Antibody, transmembrane protein 219 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA059185-25 Anti-TMEM219 Antibody, transmembrane protein 219 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM219 Antibody

Anti-TMEM219 Antibody

Target Information

  • Target Protein: Transmembrane protein 219
  • Target Gene: TMEM219
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
RNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSE

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Antigen Sequence Identity
Mouse ENSMUSG00000060538 79%
Rat ENSRNOG00000020000 28%

Product Description

Polyclonal antibody against Human TMEM219.

Recommended Applications: Immunohistochemistry (IHC)

Open Datasheet

Specifications

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.