CacheBy
Atlas Antibodies Anti-TMEM204 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM204 Antibody

상품 한눈에 보기

Human TMEM204 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB(Recombinant Expression) 검증 완료. PrEST 항원으로 친화 정제. 인간에 특이적 반응성을 가지며, 연구용으로 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA014028-100 Anti-TMEM204 Antibody, transmembrane protein 204 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014028-25 Anti-TMEM204 Antibody, transmembrane protein 204 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM204 Antibody

Anti-TMEM204 Antibody

Target: Transmembrane protein 204 (TMEM204)
Type: Polyclonal Antibody against Human TMEM204


  • Immunohistochemistry (IHC)
  • Western Blot (WB) – Recombinant expression validation using target protein overexpression

Product Description

Polyclonal antibody targeting human TMEM204, validated for IHC and WB applications.


Alternative Gene Names

C16orf30, FLJ20898

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Transmembrane protein 204
Target Gene TMEM204
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence HKREDCMAPRVIVISRSLTARFRRGLDNDYVESPC

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 일치도
Rat ENSRNOG00000016494 97%
Mouse ENSMUSG00000024168 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Application
WB Recombinant Expression
Recombinant Expression Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.