CacheBy
Atlas Antibodies Anti-TMEM174 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM174 Antibody

상품 한눈에 보기

Human TMEM174 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 정량 검증에 적합합니다. PrEST 항원으로 친화 정제되었으며, RNA-seq 데이터와의 정합으로 단백질 발현이 검증되었습니다. 40% 글리세롤/PBS 완충액에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA037975-100 Anti-TMEM174 Antibody, transmembrane protein 174 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA037975-25 Anti-TMEM174 Antibody, transmembrane protein 174 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM174 Antibody

Anti-TMEM174 Antibody

Target: Transmembrane protein 174 (TMEM174)
Type: Polyclonal Antibody against Human TMEM174


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal antibody raised in rabbit against human TMEM174.
Validated for immunohistochemistry (IHC) with orthogonal data support.


Alternative Gene Names

FLJ31268, MGC13034

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
  • Antigen Sequence:
LITSGGAAAAMSSPPQYYTIYPQDNSAFVVDEGCLSFTDGGNHRPNPDVDQLEETQLEEEACACFSPPPYEEIYSLPR

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000046082 69%
Rat ENSRNOG00000015472 65%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.