CacheBy
Atlas Antibodies Anti-TMEM168 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM168 Antibody

상품 한눈에 보기

Human TMEM168을 인식하는 Rabbit Polyclonal 항체로, IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이도 제공. Human 반응성 검증 완료. 안정한 PBS/glycerol buffer에 보존.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA077143-100 Anti-TMEM168 Antibody, transmembrane protein 168 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA077143-25 Anti-TMEM168 Antibody, transmembrane protein 168 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM168 Antibody

Anti-TMEM168 Antibody

Target: transmembrane protein 168 (TMEM168)
Type: Polyclonal Antibody against Human TMEM168


  • Immunohistochemistry (IHC)

Product Description

Rabbit polyclonal antibody raised against Human TMEM168.


Alternative Gene Names

  • DKFZp564C012
  • FLJ13576

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transmembrane protein 168
Target Gene TMEM168
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VLDSENSTPWVKEVRKINDQYIAVQGAELIKTVDIEEADPPQLGDFTKDWVEYNCNSSNNICWTEKGRTVK

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000057290 93%
Mouse ENSMUSG00000029569 92%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.