CacheBy
Atlas Antibodies Anti-TMEM158 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMEM158 Antibody

상품 한눈에 보기

Human TMEM158 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제됨. 인간 시료에 반응하며 쥐 및 랫드와 높은 서열 유사성 보유. 안정한 PBS/glycerol buffer에 보존제 포함.

카탈로그번호
HPA074974-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA074974-100 Anti-TMEM158 Antibody, transmembrane protein 158 (gene/pseudogene) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA074974-25 Anti-TMEM158 Antibody, transmembrane protein 158 (gene/pseudogene) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM158 Antibody

Anti-TMEM158 Antibody

Target Information

  • Target Protein: transmembrane protein 158 (gene/pseudogene)
  • Target Gene: TMEM158
  • Alternative Gene Names: p40BBp, RIS1

Product Description

Polyclonal antibody against Human TMEM158.

면역조직화학(IHC) 등 다양한 응용에 적합.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

TALPAYPAAEPPGPLWLQGEPLHFCCLDFSLEELQGEPGWRLNRKPIESTL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000004757 (96%)
  • Mouse ENSMUSG00000054871 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 맞는 최적 조건은 사용자가 실험적으로 결정해야 합니다.

Open Datasheet (PDF)

제품 이미지

Recommended Applications

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.