CacheBy
Atlas Antibodies Anti-TMEM100 Antibody
원본

Atlas Antibodies Anti-TMEM100 Antibody

상품 한눈에 보기

Human TMEM100 단백질을 인식하는 Rabbit Polyclonal 항체. IHC 및 WB에 적합하며, PrEST 항원을 이용해 친화 정제됨. 인간에 대한 반응성이 검증되었으며, 쥐 및 생쥐와 높은 서열 유사성을 가짐.

카탈로그번호
HPA055936-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055936-100 Anti-TMEM100 Antibody, transmembrane protein 100 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055936-25 Anti-TMEM100 Antibody, transmembrane protein 100 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMEM100 Antibody

Anti-TMEM100 Antibody

Target: Transmembrane protein 100 (TMEM100)
Type: Polyclonal Antibody (Rabbit)
Supplier: Atlas Antibodies


  • IHC (Immunohistochemistry)
  • WB (Western Blot)

Product Description

Polyclonal antibody against human TMEM100.


Alternative Gene Names

FLJ10970, FLJ37856

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATG


Verified Species Reactivity

  • Human

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000002434 (77%)
  • Mouse ENSMUSG00000069763 (72%)

Technical Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (MSDS)


Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.