CacheBy
Atlas Antibodies Anti-TMED10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TMED10 Antibody

상품 한눈에 보기

휴먼 TMED10 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Rabbit 유래 IgG 항체로, glycerol/PBS buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA047139-100 Anti-TMED10 Antibody, transmembrane emp24-like trafficking protein 10 (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047139-25 Anti-TMED10 Antibody, transmembrane emp24-like trafficking protein 10 (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TMED10 Antibody

Anti-TMED10 Antibody

Target: transmembrane emp24-like trafficking protein 10 (yeast)

  • IHC (Orthogonal validation using comparison to RNA-seq data of high and low expression tissues)
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human TMED10

Alternative Gene Names

P24(DELTA), TMP21

Open Datasheet

Target Information

항목 내용
Target Protein transmembrane emp24-like trafficking protein 10 (yeast)
Target Gene TMED10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTN

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Rat ENSRNOG00000007901 100%
Mouse ENSMUSG00000021248 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.