CacheBy
Atlas Antibodies Anti-TLE2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TLE2 Antibody

상품 한눈에 보기

Human TLE2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. PrEST 항원을 이용해 친화 정제되었으며 높은 종간 교차 반응성을 보입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA049103-100 Anti-TLE2 Antibody, transducin-like enhancer of split 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049103-25 Anti-TLE2 Antibody, transducin-like enhancer of split 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TLE2 Antibody

Anti-TLE2 Antibody

Target: transducin-like enhancer of split 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TLE2.


Alternative Gene Names

ESG, ESG2, FLJ41188, GRG2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transducin-like enhancer of split 2
Target Gene TLE2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (94%), Mouse (92%)

Antigen Sequence:
SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.