CacheBy
Atlas Antibodies Anti-TLE2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TLE2 Antibody

상품 한눈에 보기

Human TLE2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Rabbit 호스트에서 생산되었으며 IgG 아이소타입을 가집니다. PrEST 항원을 이용해 친화 정제되었으며 높은 종간 교차 반응성을 보입니다.

카탈로그번호
HPA049103-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049103-100 Anti-TLE2 Antibody, transducin-like enhancer of split 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049103-25 Anti-TLE2 Antibody, transducin-like enhancer of split 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TLE2 Antibody

Anti-TLE2 Antibody

Target: transducin-like enhancer of split 2
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TLE2.


Alternative Gene Names

ESG, ESG2, FLJ41188, GRG2

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein transducin-like enhancer of split 2
Target Gene TLE2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat (94%), Mouse (92%)

Antigen Sequence:
SDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLGSP


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.