CacheBy
Atlas Antibodies Anti-TIPIN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIPIN Antibody

상품 한눈에 보기

Human TIPIN 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합합니다. Rabbit 유래 IgG 항체이며, PrEST 항원 기반 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다.

카탈로그번호
HPA058799-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA058799-100 Anti-TIPIN Antibody, TIMELESS interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058799-25 Anti-TIPIN Antibody, TIMELESS interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIPIN Antibody

Anti-TIPIN Antibody

TIMELESS interacting protein

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human TIPIN

Alternative Gene Names

  • FLJ20516

Open Datasheet

Target Information

항목 내용
Target Protein TIMELESS interacting protein
Target Gene TIPIN
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000032397 (66%), Rat ENSRNOG00000043068 (59%)

Antigen Sequence:
EEQQQRIERNKQLALERRQAKLLSNSQTLGNDMLMNTPRAHTVEEVNTDEDQKEESNGLNEDILDNPCNDAIA

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.