CacheBy
Atlas Antibodies Anti-TIMM10 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-TIMM10 Antibody

상품 한눈에 보기

Human TIMM10 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 ICC 응용에 적합. PrEST 항원으로 친화 정제됨. 40% 글리세롤 및 PBS 완충액에 보존제 포함. 인간, 쥐, 랫트에 반응.

카탈로그번호
HPA039946-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA039946-100 Anti-TIMM10 Antibody, translocase of inner mitochondrial membrane 10 homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA039946-25 Anti-TIMM10 Antibody, translocase of inner mitochondrial membrane 10 homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-TIMM10 Antibody

Anti-TIMM10 Antibody

Target: translocase of inner mitochondrial membrane 10 homolog (yeast)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human TIMM10.


Alternative Gene Names

TIM10, TIM10A

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein translocase of inner mitochondrial membrane 10 homolog (yeast)
Target Gene TIMM10
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007883 (100%), Mouse ENSMUSG00000027076 (100%)

Antigen Sequence (AA):
MDPLRAQQLAAELEVEMMADMYNRMTSACHRKCVPPHYKEAELSKGESVCLDRCVSKYLDIHERMGKKLTELSMQDEELMKRVQQSSGPA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.