CacheBy
Atlas Antibodies Anti-THYN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-THYN1 Antibody

상품 한눈에 보기

Human THYN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. 고순도 Affinity 정제 방식으로 제조되었으며, 사람, 생쥐, 랫트 시료에 반응합니다. 40% 글리세롤 기반 PBS 완충액에 보존되어 안정성이 우수합니다.

카탈로그번호
HPA038732-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038732-100 Anti-THYN1 Antibody, thymocyte nuclear protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038732-25 Anti-THYN1 Antibody, thymocyte nuclear protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-THYN1 Antibody

Anti-THYN1 Antibody

Target: Thymocyte nuclear protein 1 (THYN1)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human THYN1.


Alternative Gene Names

  • THY28

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Thymocyte nuclear protein 1
Target Gene THYN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL

Species Reactivity

반응성
Human Verified
Mouse Verified
Rat Verified

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000047053 (93%)
  • Mouse ENSMUSG00000035443 (93%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer PBS (pH 7.2) with 40% glycerol
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.