CacheBy
Atlas Antibodies Anti-THEMIS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-THEMIS2 Antibody

상품 한눈에 보기

Human THEMIS2 단백질을 인식하는 토끼 폴리클로날 항체로, 면역세포 관련 연구에 적합. PrEST 항원으로 정제되어 높은 특이성과 재현성 제공. 인간에 대한 검증 완료, Rat 및 Mouse와 교차반응 가능성 있음. 다양한 면역학적 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA031096-100 Anti-THEMIS2 Antibody, thymocyte selection associated family member 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA031096-25 Anti-THEMIS2 Antibody, thymocyte selection associated family member 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-THEMIS2 Antibody

Anti-THEMIS2 Antibody

Target: thymocyte selection associated family member 2 (THEMIS2)
Supplier: Atlas Antibodies

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human THEMIS2.

Alternative Gene Names

C1orf38, ICB-1

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein thymocyte selection associated family member 2
Target Gene THEMIS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GEREENPEFTSLAVGDRLEVLGPGQAHGAQGSDVDVLVCQRLSDQAGEDEEEECKEEAESPERVLLPFHFPGSF

Verified Species Reactivity

  • Human

Interspecies Information

종 Ortholog ID 항원 서열 일치율
Rat ENSRNOG00000012965 64%
Mouse ENSMUSG00000037731 62%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 설명
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.