CacheBy
Atlas Antibodies Anti-THBS3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-THBS3 Antibody

상품 한눈에 보기

인간 THBS3 단백질을 인식하는 폴리클로날 항체로, 토끼에서 생산되었습니다. PrEST 항원을 이용해 친화 정제되었으며, 면역세포 염색(ICC) 등 다양한 응용에 적합합니다. 인체 반응성이 검증되었고, 글리세롤 보존 용액에 포함되어 안정적입니다.

카탈로그번호
HPA073242-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA073242-100 Anti-THBS3 Antibody, thrombospondin 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA073242-25 Anti-THBS3 Antibody, thrombospondin 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-THBS3 Antibody

Anti-THBS3 Antibody

Target Information

  • Target Protein: Thrombospondin 3
  • Target Gene: THBS3
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
VGALSECPFQGDESIHSAVTNALHSILGEQTKALVTQLTLFNQILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRS

Product Description

Polyclonal antibody against human THBS3.

Open Datasheet

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000059903 (96%)
  • Mouse ENSMUSG00000028047 (95%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Immunocytochemistry (ICC)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.