Merck Anti-SLC25A21 antibody produced in rabbit
토끼에서 생산된 Anti-SLC25A21 항체로, 인간 SLC25A21 단백질을 인식하는 polyclonal 항체입니다. Prestige Antibodies® 라인 제품으로, Western blot 및 IHC에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-SLC25A21 antibody produced in rabbit
Anti-SLC25A21 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated primary antibody (unconjugated), buffered aqueous glycerol solution.
대상 단백질: Solute carrier family 25 member 21 (SLC25A21), Mitochondrial 2-oxodicarboxylate carrier
생물학적 소스: Rabbit
항체 유형: Polyclonal
제품 사양
| 항목 | 내용 |
|---|---|
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 항체 형태 | Affinity isolated antibody |
| 결합 | Unconjugated |
| 항체 유형 | Primary antibody |
| 생물학적 소스 | Rabbit |
| 종 특이성 | Human |
| 포장 | 25 μL (small pack) |
| 형태 | Buffered aqueous glycerol solution |
| Quality Level | 100 |
| 면역원 서열 | PEVSLVREASRQIVAGGSAGLVEICLMHPLDVVKTRFQIQRCATDPNSYKSLVDSFRMIFQMEGLFGFYKGILPPILAETPKRAVKFFTFEQYKKLLGYVSLSPALTFAIAGLGSGLTEAIVVNPFEVVKVGL |
| UniProt 번호 | Q9BQT8 |
| 기술 | Immunoblotting (0.04–0.4 μg/mL), Immunohistochemistry (1:50–1:200) |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
유전자 정보
Gene: SLC25A21 (89874)
설명:
Mitochondrial 2-oxodicarboxylate carrier, also known as solute carrier family 25 member 21 (SLC25A21), is a protein encoded by the SLC25A21 gene in humans. It belongs to a large family of nuclear-encoded transporters and is localized in the inner mitochondrial membrane. It possesses a tripartite structure with six transmembrane α-helices and three repeated signature motifs.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.