Anti-ADAMTS5 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-ADAM-TS 5 antibody produced in rabbit, Anti-ADAMTS-5 precursor antibody produced in rabbit, Anti-A disintegrin and metalloproteinase with thrombospondin motifs 5 antibody produced in rabbit, Anti-ADMP-2 antibody produced in rabbit, Anti-Aggrecanase-2 antibody produced in rabbit, Anti-ADAM-TS 11 antibody produced in rabbit, Anti-ADAM-TS5 antibody produced in rabbit
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
antibody product type
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
form
buffered aqueous glycerol solution
species reactivity
human
포장
antibody small pack of 25 μL
technique(s)
immunohistochemistry: 1:50- 1:200
면역원 서열
KGLVQNIDQLYSGGGKVGYLVYAGGRRFLLDLERDGSVGIAGFVPAGGGTSAPWRHRSHCFYRGTVDGSPRSLAVFDLCGGLDGFFAVKHARYTLKPLLRGPWAEEEKGRVYGDGS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
Gene Information
human ... ADAMTS5(11096)
ADAM metallopeptidase with thrombospondin motifs 5 (ADAMTS5) belongs to the ADAM protein family. It has an ADAM-like protease domain, a disintegrin-like domain and a cysteine-rich domain. ADAMTS5 lacks a transmembrane domain and is thus secreted into the extracellular matrix.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.