Merck Anti-TNIK antibody produced in rabbit
Rabbit에서 생산된 Anti-TNIK 다클론 항체로, 인간 TNIK 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품이며, 면역형광 및 면역조직화학에 적합합니다. −20°C에서 보관하며 습식 얼음 상태로 배송됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TNIK antibody produced in rabbit
Anti-TNIK antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-TRAF2 and NCK-interacting protein kinase
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 종류
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장 단위
antibody small pack of 25 μL
적용 기술
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
QGPALTASQSVHEQPTKGLSGFQEALNVTSHRVEMPRQNSDPTSENPPLPTRIEKFDRSSWLRQEEDIPPKVPQRTTSISPALARKNSPGNGSALGPRLGSQPIRASNPDLRRTEPILESPLQRTSSGSSSSSS
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Human TNIK (23043)
TRAF2 and NCK-interacting protein kinase recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Packaging | 25 μL |
| Applications | IF (0.25–2 μg/mL), IHC (1:50–1:200) |
| Storage Temp | −20°C |
| Shipping Condition | Wet ice |
| UniProt Accession | Q9UKE5 |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.