AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CBLB antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-CBLB 항체로, 인간 CBLB 단백질을 인식하는 polyclonal primary antibody입니다. Prestige Antibodies® 제품군으로 IHC에 적합하며, −20°C에서 보관합니다. buffered aqueous glycerol 용액 형태로 제공됩니다.
- 카탈로그번호
- HPA018327-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA018327-100UL Anti-CBLB antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
817,800원VAT 포함 899,580원
Merck Sigma · Merck Anti-CBLB antibody produced in rabbit
Anti-CBLB antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 affinity isolated 항체로, buffered aqueous glycerol solution 형태로 제공됩니다.
Casitas B-lineage lymphoma proto-oncogene b (CBLB)를 인식하며, RING finger protein 56, Signal transduction protein CBL-B, SH3-binding protein CBL-B, E3 ubiquitin-protein ligase CBL-B 등에 대한 항체로도 알려져 있습니다.
생물학적 정보
- Source: Rabbit
- Species Reactivity: Human
- Gene Information: Human CBLB (868), located on chromosome 3q13.11
The gene belongs to the CBL family of ubiquitin ligases.
제품 사양
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Form | Affinity isolated antibody |
| Product Type | Primary antibodies |
| Clone | Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Packaging | Antibody small pack of 25 μL |
| Technique(s) | Immunohistochemistry: 1:50–1:200 |
| Immunogen Sequence | PPGSSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQAPARPPKPRPRRTAPEIHHRKP |
| UniProt Accession | Q13191 |
| Shipping Conditions | Wet ice |
| Storage Temperature | −20°C |
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.