AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-ZDHHC20 antibody produced in rabbit
상품 한눈에 보기
Rabbit polyclonal antibody targeting ZDHHC20, a zinc finger DHHC domain-containing protein. Suitable for immunohistochemistry (IHC) applications. Supplied as an affinity-isolated antibody in buffered aqueous glycerol solution. Reacts with human samples...
- 카탈로그번호
- HPA014483-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA014483-100UL Anti-ZDHHC20 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,700원VAT 포함 1,012,770원
Merck Sigma · Merck Anti-ZDHHC20 antibody produced in rabbit
Anti-ZDHHC20 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody in buffered aqueous glycerol solution.
Target Information
- Anti-Palmitoyltransferase ZDHHC20 (probable)
- Anti-Zinc finger DHHC domain-containing protein 20
- Anti-DHHC-20
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 제형 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 적용 기술 | Immunohistochemistry (IHC): 1:20–1:50 |
| 면역원 서열 | SKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCV |
| UniProt 번호 | Q5W0Z9 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human ZDHHC20 (253832)
Zinc finger DHHC domain-containing protein 20 (ZDHHC20), also known as DHHC-20, is homologous to Pfa3 of yeast and localized in the plasma membrane. It is expressed in placenta, testis, heart, brain, leukocytes, liver, lungs, and thymus. Increased expression has been observed in human tumors such as ovarian, breast, and prostate cancers.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.