
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-CALCRL antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-CALCRL antibody는 rabbit에서 생산된 polyclonal primary antibody로, 인간 CALCRL 단백질을 인식합니다. Prestige Antibodies® 제품군으로 높은 품질을 보장하며, 면역조직화학(IHC)에 사용 가능합니다. −20°C에서 보관하며, 25 μL 포장으로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-CALCRL antibody produced in rabbit
Anti-CALCRL antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Calcitonin gene-related peptide type 1 receptor precursor, Anti-CGRP type 1 receptor, Anti-Calcitonin receptor-like receptor
생물학적 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 형태 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 기술 적용 | Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA |
| UniProt 수납 번호 | Q16602 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human gene CALCRL (Calcitonin gene-related peptide type 1 receptor) is mapped to chromosome 2q32.1 and contains 15 exons interspaced by 14 introns.
Exons 1–3 form the non-coding region, while exons 4–15 comprise the coding region.
Exons 8–14 encode seven transmembrane domains.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



