CacheBy
Merck Anti-CALCRL antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-CALCRL antibody produced in rabbit

상품 한눈에 보기

Merck의 Anti-CALCRL antibody는 rabbit에서 생산된 polyclonal primary antibody로, 인간 CALCRL 단백질을 인식합니다. Prestige Antibodies® 제품군으로 높은 품질을 보장하며, 면역조직화학(IHC)에 사용 가능합니다. −20°C에서 보관하며, 25 μL 포장으로 제공됩니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-CALCRL antibody produced in rabbit

Anti-CALCRL antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-Calcitonin gene-related peptide type 1 receptor precursor, Anti-CGRP type 1 receptor, Anti-Calcitonin receptor-like receptor

생물학적 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 형태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 Buffered aqueous glycerol solution
Species Reactivity Human
포장 Antibody small pack of 25 μL
기술 적용 Immunohistochemistry: 1:50–1:200
면역원 서열 EDSIQLGVTRNKIMTAQYECYQKIMQDPIQQAEGVYCNRTWDGWLCWNDVAAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASNRTWTNYTQCNVNTHEKVKTA
UniProt 수납 번호 Q16602
배송 상태 Wet ice
저장 온도 −20°C

Gene Information

Human gene CALCRL (Calcitonin gene-related peptide type 1 receptor) is mapped to chromosome 2q32.1 and contains 15 exons interspaced by 14 introns.
Exons 1–3 form the non-coding region, while exons 4–15 comprise the coding region.
Exons 8–14 encode seven transmembrane domains.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.