AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-C9orf72 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-C9orf72 폴리클로날 항체로 인간 C9orf72 단백질을 인식합니다. Prestige Antibodies® 제품군으로 면역조직화학(IHC)에 적합하며, 친화 정제된 glycerol 완충 용액 형태로 제공됩니다. −20°C에서 보관하며 wet ice로 배송됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-C9orf72 antibody produced in rabbit
Anti-C9orf72 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-Uncharacterized protein C9orf72
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 타입 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 적용 기술 | Immunohistochemistry (IHC): 1:50–1:200 |
| 면역원 서열 | YGLSIILPQTELSFYLPLHRVCVDRLTHIIRKGRIWMHKERQENVQKIILEGTERMEDQGQSIIPMLTGEVIPVMELLSSMKSHSVPEEI |
| UniProt 번호 | Q96LT7 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
C9orf72 (203228)
Chromosome 9 open reading frame 72 (C9orf72) gene is mapped to human chromosome 9p21.
The gene codes for a highly conserved uncharacterized protein.
It is expressed in various tissues such as cerebellum, cortex, and spinal cord.
C9orf72 gene contains hexanucleotide GGGGCC repeat in its noncoding region.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.