
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-HCLS1 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-HCLS1 rabbit polyclonal antibody는 인간 HCLS1 단백질을 인식하며, Prestige Antibodies® 라인 제품입니다. 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 비결합 상태의 affinity isolated 항체로 buffered glycerol 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-HCLS1 antibody produced in rabbit
Anti-HCLS1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Aliases:
Anti-p75, Anti-Hematopoietic cell-specific LYN substrate 1, Anti-LckBP1, Anti-Hematopoietic lineage cell-specific protein
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 적용 기술 | Immunohistochemistry (IHC): 1:2500–1:5000 |
| 면역원 서열 | PTTAYKKTTPIEAASSGTRGLKAKFESMAEEKRKREEEEKAQQVARRQQERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSRE |
| UniProt 수납 번호 | P14317 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human gene: HCLS1 (3059)
The gene HCLS1 (hematopoietic lineage cell-specific protein) is mapped to human chromosome 3q13. It is present in hematopoietic cells. The protein contains helix-turn-helix and Src homology 3 motifs.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



