CacheBy
Merck Anti-ARHGEF12 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-ARHGEF12 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-ARHGEF12 폴리클로날 항체로, 인간 단백질에 반응하며 면역형광 및 면역조직화학에 적합합니다. Prestige Antibodies® 라인 제품으로 친화 정제된 항체이며, −20°C에서 보관합니다.

브랜드
Merck Sigma
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
Merck HPA018911-100UL Anti-ARHGEF12 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원

Merck Sigma · Merck Anti-ARHGEF12 antibody produced in rabbit

Anti-ARHGEF12 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution

Aliases: Anti-Leukemia-associated RhoGEF, Anti-Rho guanine nucleotide exchange factor 12


제품 정보

항목 내용
생물학적 소스 Rabbit
품질 등급 100
결합 상태 Unconjugated
항체 형태 Affinity isolated antibody
항체 유형 Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
제형 Buffered aqueous glycerol solution
반응 종 Human
포장 25 μL (small pack)
실험 기술 Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:1000–1:2500
면역원 서열 MAASVKEQSTKPIPLPQSTPGEGDNDEEDPSKLKEEQHGISVTGLQSPDRDLGLESTLISSKPQSHSLSTSGKSEVRDLFVAERQFAKEQHTDGTLKEVGEDYQ
UniProt 번호 Q9NZN5
배송 상태 Wet ice
저장 온도 −20°C
유전자 정보 Human ARHGEF12(23365)

Gene Information

The gene ARHGEF12 (Rho guanine nucleotide exchange factor 12) is mapped to human chromosome 11q23.3.
The protein contains:

  • PDZ (PSD-95/Dlg/ZO-1) domain
  • LH/RGS (regulator of G protein signaling) domain
  • DH (Dbl homology) domain
  • PH (pleckstrin homology) domain

It is highly expressed in glioma, gastric cancer, and intestinal cancer cell lines.
In MDCK (Madin-Darby canine kidney)-II epithelial cells, the protein localizes at the lateral membranes and in the cytoplasm.
ARHGEF12 co-localizes with α-tubulin at the spindle poles and during cytokinesis, it is present in the midbody.
ARHGEF12 is also known as LARG (Leukemia-associated RhoGEF).

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.