CacheBy
Merck Anti-MALSU1 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-MALSU1 antibody produced in rabbit

상품 한눈에 보기

토끼에서 생산된 Anti-MALSU1 항체로, 인간 MALSU1 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로 Western blot, IF, IHC에 적합합니다. −20°C 보관, glycerol 완충 용액 형태로 공급됩니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-MALSU1 antibody produced in rabbit

Anti-MALSU1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies

Affinity isolated antibody, buffered aqueous glycerol solution
Also known as Anti-C7orf30, Anti-mtRsfA


제품 정보

항목 내용
생물학적 소스 Rabbit
Quality Level 100
결합 Unconjugated
항체 형태 Affinity isolated antibody
Antibody product type Primary antibodies
클론 Polyclonal
제품 라인 Prestige Antibodies® Powered by Atlas Antibodies
형태 (Form) Buffered aqueous glycerol solution
Species reactivity Human
포장 Antibody small pack of 25 μL
배송 상태 Wet ice
저장 온도 −20°C

실험 적용 (Applications)

Technique Working concentration / dilution
Immunoblotting (WB) 0.04–0.4 μg/mL
Immunofluorescence (IF) 0.25–2 μg/mL
Immunohistochemistry (IHC) 1:200–1:500

면역원 서열 (Immunogen sequence)

AFYVVKMYKHLKCKRDPHVKIEGKDTDDWLCVDFGSMVIHLMLPETREIYELEKLWTLRSYDDQLAQIAPETVPEDFILGIEDDTSSVTPV

Gene Information

Human gene: C7orf30 (115416)
Mitochondrial assembly of ribosomal large subunit 1 (MALSU1) is located in the mitochondria and belongs to the iojap protein family.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.