
Merck Anti-ARHGEF4 antibody produced in rabbit
Merck의 Anti-ARHGEF4 antibody는 rabbit에서 생산된 polyclonal primary antibody로, 인간 ARHGEF4 단백질을 인식합니다. Immunohistochemistry(1:20–1:50)에 적합하며, Prestige Antibodies® 라인 제품입니다. −20°C에서 보관하며 wet ice 상태로 배송됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-ARHGEF4 antibody produced in rabbit
Anti-ARHGEF4 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-Asef, Anti-Rho guanine nucleotide exchange factor 4, Anti-APC-stimulated guanine nucleotide exchange factor
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
immunohistochemistry: 1:20–1:50
면역원 서열
VLYYKGRLDMDGLEVVDLEDGKDRDLHVSIKNAFRLHRGATGDSHLLCTRKPEQKQRWLKAFAREREQVQLDQETG
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ARHGEF4 (50649)
The gene rho guanine nucleotide exchange factor-4 (ARHGEF4) is mapped to human chromosome 2q22.
ARHGEF4 transcript has been detected in brain, skeletal muscle, and testis.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Antibody Type | Primary, Polyclonal |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Technique(s) | Immunohistochemistry (1:20–1:50) |
| Packaging | 25 μL small pack |
| Storage Temperature | −20°C |
| Shipment Condition | Wet ice |
| UniProt Accession | Q9NR80 |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



