AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-TCF4 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-TCF4 항체로, 인간 TCF4 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로 면역조직화학(IHC)에 적합하며, −20°C에서 보관합니다. 버퍼링된 글리세롤 수용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TCF4 antibody produced in rabbit
Anti-TCF4 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms:
Anti-ITF-2, Anti-Transcription factor 4, Anti-SL3-3 enhancer factor 2, Anti-Immunoglobulin transcription factor 2, Anti-SEF-2
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | 25 μL (small pack) |
| 적용 기술(Technique) | Immunohistochemistry (1:50–1:200) |
| 면역원 서열 (Immunogen sequence) | HGIIGPSHNGAMGGLGSGYGTGLLSANRHSLMVGTHREDGVALRGSHSLLPNQVPVPQLPVQSATSPDLNPPQDPYRGMPPGLQGQSVSSGSSEIKSDDEGDENLQD |
| UniProt 번호 | P15884 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human gene: TCF4 (6925)
The TCF4 (transcription factor 4) gene is mapped to human chromosome 18q21.2.
TCF4 codes for an E-protein with a basic helix–loop–helix structure and is predominantly expressed in the brain.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.