
Merck Anti-ZZEF1 antibody produced in rabbit
Merck Prestige Antibodies® 라인의 rabbit polyclonal anti-ZZEF1 항체로, 인간 ZZEF1 단백질에 특이적입니다. Immunofluorescence 및 Immunohistochemistry에 적합하며, −20°C에서 보관합니다. Affinity isolated, buffered glycerol 용액 형태로 제공됩니다.
- 카탈로그번호
- HPA031778-100UL
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-ZZEF1 antibody produced in rabbit
Anti-ZZEF1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab1
관련 항체명
Anti-FLJ10821, Anti-PHF18, Anti-SPP1, Anti-ZCGPC1, Anti-CFP1, Anti-CGBP, Anti-zinc finger, ZZ-type with EF-hand domain 1, Anti-HsT2645, Anti-KIAA0399, Anti-PCCX1, Anti-ZZZ4, Anti-hCGBP
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
- Immunofluorescence: 0.25–2 μg/mL
- Immunohistochemistry: 1:200–1:500
면역원 서열
DYFFLEVQKRFDGDELTTDERIRSLAQRWQPSKSLRLEEQSAKAVDTDMIILPCLSRPARCDQATAESNPVTQKLI
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ZZEF1 (Gene ID: 23140)
Zinc finger, ZZ-type with EF-hand domain 1 recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Source | Rabbit |
| Type | Polyclonal, Primary |
| Form | Buffered aqueous glycerol solution |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Pack Size | 25 μL |
| Storage Temp | −20°C |
| Shipping Condition | Wet ice |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| Applications | IF (0.25–2 μg/mL), IHC (1:200–1:500) |
| UniProt | O43149 |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



