AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-NFATC4 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-NFATC4 polyclonal 항체로, Prestige Antibodies® Powered by Atlas Antibodies 제품입니다. 인간 NFATC4 단백질에 반응하며, 면역조직화학(IHC)에 적합합니다. −20°C에서 보관하며, 25 μL 소포장으로 제공됩니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-NFATC4 antibody produced in rabbit
Anti-NFATC4 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-NFAT3 / Anti-nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4
생물학적 소스
rabbit
제품 사양
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | unconjugated |
| 항체 형태 | affinity isolated antibody |
| antibody product type | primary antibodies |
| 클론 | polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(form) | buffered aqueous glycerol solution |
| species reactivity | human |
| 포장 | antibody small pack of 25 μL |
| technique(s) | immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | SACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRPPYPSYPHEDPAC |
| UniProt 수납 번호 | Q14934 |
| 배송 상태 | wet ice |
| 저장 온도 | −20°C |
Gene Information
human ... NFATC4(4776)
nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 4 recombinant protein epitope signature tag (PrEST)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.