
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-USE1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-USE1 항체로, 인간 USE1 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로 Western blot과 IHC에 적합하며, affinity purified 형태로 제공됩니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-USE1 antibody produced in rabbit
Anti-USE1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 affinity isolated 항체로, buffered aqueous glycerol solution 형태입니다.
이 항체는 SLT1, p31, unconventional SNARE in the ER 1 homolog (S. cerevisiae), MDS032, RGL 등에 대한 항체로도 알려져 있습니다.
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody product type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| 포장 | 25 μL (antibody small pack) |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | RSELLGTDSAEPEMDVRKRTGVAGSQPVSEKQSAAELDLVLQRHQNLQEKLAEEMLGLARSLKTNTLAAQSVIKKDNQTLSHSLKMADQNLEKLKTESERLEQHTQKSVNW |
| UniProt 수납 번호 | Q9NZ43 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human USE1 (55850) |
추가 정보
Unconventional SNARE in the ER 1 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



