Merck Anti-GTF2E2 antibody produced in rabbit
토끼에서 생산된 Anti-GTF2E2 폴리클로날 항체로, Atlas Antibodies의 Prestige Antibodies® 라인 제품입니다. 인간, 생쥐, 랫트 반응성이 있으며 immunoblotting, immunofluorescence, immunohistochemistry에 적합합니다. −20°C에서 보관하며 wet ice로 배송됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-GTF2E2 antibody produced in rabbit
Anti-GTF2E2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Anti-TF2E2, Anti-NCRNA00196, Anti-general transcription factor IIE, polypeptide 2, β, Anti-FE, Anti-TFIIE-B
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
종 반응성
mouse, rat, human
포장
antibody small pack of 25 μL
적용 기술
| Technique | 사용 농도 |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunofluorescence | 0.25–2 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
PSLLRERELFKKRALSTPVVEKRSASSESSSSSSKKKKTKVEHGGSSGSKQNSDHSNGSFNLKALSGSSGYKFGVL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human ... GTF2E2(2961)
The gene GTF2E2 (general transcription factor IIE subunit 2) is mapped to human chromosome 8p12.
The protein has a serine-rich region, a centrally located forkhead domain, a leucine repeat motif, a region similar to the bacterial σ factor subdomain 3, a bHLH (basic region-helix-loop-helix) motif and a bHL (basic region-helix-loop) sequence.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.