
Merck Anti-KCNV2 antibody produced in rabbit
토끼에서 생산된 Anti-KCNV2 폴리클로날 항체로 인간 KCNV2 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며 면역조직화학(IHC)에 적합합니다. 친화 정제된 항체로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-KCNV2 antibody produced in rabbit
Anti-KCNV2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-Kv8.2 / Anti-potassium channel, subfamily V, member 2
생물학적 소스
rabbit
품질 등급
100
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
- Immunohistochemistry (IHC): 1:500–1:1000
면역원 서열
WNTTENEGSQHRRSICSLGARSGSQASIHGWTEGNYNYYIEEDEDGEEEDQWKDDLAEEDQQAGEVTTAKPEGPSDPPALLSTLNVNVGGHSYQLDYCELA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human KCNV2(169522)
The KCNV2 (potassium channel, subfamily V, member 2) gene is mapped to human chromosome 9p24.2.
KCNV2 is highly expressed in retinal photoreceptors and encodes a modulatory subunit of the Kv8.2 voltage-gated potassium channel.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Product Type | Primary Antibody |
| Clone | Polyclonal |
| Conjugation | Unconjugated |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| Application | IHC (1:500–1:1000) |
| Packaging | 25 μL |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
| Product Line | Prestige Antibodies® Powered by Atlas Antibodies |
| UniProt Accession | Q8TDN2 |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



