
Merck Anti-SNX16 antibody produced in rabbit
Rabbit polyclonal antibody targeting SNX16, part of the Prestige Antibodies® line powered by Atlas Antibodies. Suitable for human, rat, and mouse samples. Ideal for immunoblotting and immunohistochemistry. Supplied as a buffered aqueous glycerol soluti...
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-SNX16 antibody produced in rabbit
Anti-SNX16 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution (ab1).
Anti-sorting nexin 16 antibody.
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human, rat, mouse
포장
antibody small pack of 25 μL
적용 기술
| Technique | Dilution / Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunohistochemistry | 1:50–1:200 |
면역원 서열
FPGFRLALPPKRWFKDNYNADFLEDRQLGLQAFLQNLVAHKDIANCLAVREFLCLDDPPGPFDSLEESRAFCETLEETNYRLQKELLEKQKEMESL
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human SNX16 (64089)
SNX16 (sorting nexin 16)은 인간 염색체 8q21.13에 위치하며 sorting nexin (SNX) 단백질 계열에 속합니다. 이 단백질은 coiled coil domain과 PX domain을 포함하여 막 결합에 관여하며, early 및 late endosomes/lysosomes에 존재합니다.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



