
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-TMTC2 antibody produced in rabbit
상품 한눈에 보기
Merck의 Anti-TMTC2 항체는 rabbit에서 생산된 polyclonal primary antibody로, Prestige Antibodies® Powered by Atlas Antibodies 라인 제품입니다. 인간, 마우스, 랫트 시료에 반응하며 immunoblotting, immunofluorescence, immunohistochemistry에 적합합니다. −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-TMTC2 antibody produced in rabbit
Anti-TMTC2 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution, ab1
대상 항원:
Anti-transmembrane and tetratricopeptide repeat containing 2 (TMTC2),
Anti-DKFZp762A217, Anti-N27C7-4, Anti-C22orf16
생물학적 소스
rabbit
제품 스펙
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 타입 | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Mouse, Human, Rat |
| 포장 | 25 μL (Small pack) |
| Technique(s) | Immunoblotting: 0.04–0.4 μg/mL Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:200–1:500 |
| 면역원 서열 | MMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAHLTYGKLLALTGRKSEAEKLFLKAIELDPTKGNCYMHYGQFLLEEARLIEAAEMAKKAAELDSTEFDVVFNAAHMLRQASLNEAAEKYYDLAARLRPNYPAALMNLGAIL |
| UniProt 수납 번호 | Q8N394 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
Gene Information
Human TMTC2 (160335)
Transmembrane and tetratricopeptide repeat containing 2 recombinant protein epitope signature tag (PrEST)
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



