AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-NAA25 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-NAA25 항체로, 인간 NAA25 단백질을 특이적으로 인식합니다. Prestige Antibodies® 라인 제품으로 Western blot, IF, IHC에 적합합니다. 비결합형 다클론 항체이며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-NAA25 antibody produced in rabbit
Anti-NAA25 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Synonyms
Anti-N(α)-acetyltransferase 25, NatB auxiliary subunit, Anti-C12orf30, Anti-FLJ13089
제품 정보
| 항목 | 내용 |
|---|---|
| Biological source | Rabbit |
| Quality level | 100 |
| Conjugate | Unconjugated |
| Antibody form | Affinity isolated antibody |
| Antibody type | Primary antibodies |
| Clone | Polyclonal |
| Product line | Prestige Antibodies® Powered by Atlas Antibodies |
| Form | Buffered aqueous glycerol solution |
| Species reactivity | Human |
| Packaging | Antibody small pack of 25 μL |
| Shipping condition | Wet ice |
| Storage temperature | −20 °C |
실험 적용
| Technique | Recommended concentration |
|---|---|
| Immunoblotting (WB) | 0.04–0.4 μg/mL |
| Immunofluorescence (IF) | 0.25–2 μg/mL |
| Immunohistochemistry (IHC) | 1:50–1:200 |
면역원 서열
TGKRFIEKDIQYPFLGPVPTRMGGFFNSGCSQCQISSFYLVNDIYELDTSGLEDTMEIQERIENSFKSLLDQLKDVFSKCKGDLLUniProt 수납 번호
Gene Information
Human NAA25 (80018)
The gene NAA25 (N(α)-acetyltransferase 25) is mapped to human chromosome 12.
The encoded protein functions as an auxiliary subunit of the NatB (N-terminal acetyltransferase) complex.
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.