AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-MRPL44 antibody produced in rabbit
상품 한눈에 보기
Rabbit polyclonal antibody against MRPL44, suitable for human samples. Affinity isolated and supplied in buffered aqueous glycerol solution. Ideal for immunofluorescence and immunohistochemistry. Stored at −20°C and shipped on wet ice.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA038147-100UL Anti-MRPL44 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-MRPL44 antibody produced in rabbit
Anti-MRPL44 Antibody Produced in Rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution.
Aliases:
Anti-FLJ13990, Anti-Mitochondrial ribosomal protein L44, Anti-FLJ12701
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| Antibody Product Type | Primary antibodies |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태(Form) | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| Technique(s) | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:500–1:1000 |
| 면역원 서열 | GLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAE |
| UniProt 수납 번호 | Q9H9J2 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20°C |
| Gene Information | Human MRPL44 (65080) – mitochondrial ribosomal protein L44 recombinant protein epitope signature tag (PrEST) |
제품 이미지
(해당 제품 이미지가 있을 경우 여기에 배치)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.