Merck Anti-CPSF3 antibody produced in rabbit
Merck Sigma의 Anti-CPSF3 항체는 rabbit에서 생산된 polyclonal 1차 항체로, CPSF3 단백질(73kDa)을 인식합니다. Human, mouse, rat 시료에 반응하며, IHC 및 Western blot에 적합합니다. Prestige Antibodies® Powered by Atlas Antibodies 제품으로 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Merck Sigma · Merck Anti-CPSF3 antibody produced in rabbit
Anti-CPSF3 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Target: Cleavage and polyadenylation specific factor 3 (CPSF3, 73kDa)
Synonyms: Anti-YSH1, Anti-CPSF-73, Anti-CPSF73
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 종류
primary, polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human, mouse, rat
포장
25 μL (small pack)
사용 기술
- Immunoblotting: 0.04–0.4 μg/mL
- Immunohistochemistry: 1:50–1:200
면역원 서열
PFNLLCYQLQKLTGDVEELEIQEKPALKVFKNITVIQEPGMVVLEWLANPSNDMYADTVTTVILEVQSNPKIRKGAVQK
UniProt 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
Human CPSF3 (51692)
Cleavage and polyadenylation specific factor 3, 73kDa recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugation | Unconjugated |
| Antibody Type | Primary, Polyclonal |
| Form | Buffered aqueous glycerol solution |
| Species Reactivity | Human, Mouse, Rat |
| Packaging | 25 μL |
| Application | Immunoblotting, Immunohistochemistry |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
제품 이미지
(이미지 없음 또는 제공되지 않음)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.