CacheBy
Merck Anti-EPC2 antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-EPC2 antibody produced in rabbit

상품 한눈에 보기

Merck의 Anti-EPC2 rabbit polyclonal antibody는 인간 EPC2 단백질을 인식하는 프레스티지 항체로, 면역형광 및 면역조직화학에 적합합니다. 친화 정제된 glycerol buffer 형태로 제공되며 −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-EPC2 antibody produced in rabbit

Anti-EPC2 antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies — affinity isolated antibody, buffered aqueous glycerol solution
Anti-Enhancer of Polycomb homolog 2 (Drosophila), Anti-DKFZP566F2124

생물학적 정보

  • Biological source: Rabbit
  • Clonality: Polyclonal
  • Conjugate: Unconjugated
  • Antibody type: Primary antibody
  • Product line: Prestige Antibodies® Powered by Atlas Antibodies

물리적 특성

  • Form: Buffered aqueous glycerol solution
  • Packaging: Small pack of 25 μL
  • Species reactivity: Human
  • Storage temperature: −20 °C
  • Shipping condition: Wet ice

실험 적용

Technique Recommended concentration/dilution
Immunofluorescence 0.25–2 μg/mL
Immunohistochemistry 1:50–1:200

품질 및 기타 정보

항목 내용
Quality level 100
Immunogen sequence YATPATLHNGNHHKVQECKTKHPHHLSLKEEASDVVRQKKKYPKKPKAEALITSQQPTPETLPVINKSDIKQYDFHSSDEDEFPQVLS
UniProt accession Q52LR7
Gene information human EPC2 (26122)
Protein description Enhancer of polycomb homolog 2 (Drosophila) recombinant protein epitope signature tag (PrEST)

제품 이미지

(이미지 없음)

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.