
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-GUCA1C antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-GUCA1C 항체로, 인간 GUCA1C 단백질을 인식하는 polyclonal 1차 항체입니다. Prestige Antibodies® 라인 제품으로 면역형광 및 면역조직화학에 적합하며, −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA041597-100UL Anti-GUCA1C antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-GUCA1C antibody produced in rabbit
Anti-GUCA1C antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Also known as Anti-Gcap3, Anti-Guanylate cyclase activator 1c
제품 정보
| 항목 | 내용 |
|---|---|
| 생물학적 소스 | Rabbit |
| Quality Level | 100 |
| 결합 | Unconjugated |
| 항체 형태 | Affinity isolated antibody |
| 항체 유형 | Primary antibody |
| 클론 | Polyclonal |
| 제품 라인 | Prestige Antibodies® Powered by Atlas Antibodies |
| 형태 | Buffered aqueous glycerol solution |
| Species Reactivity | Human |
| 포장 | Antibody small pack of 25 μL |
| 적용 기술 | Immunofluorescence: 0.25–2 μg/mL Immunohistochemistry: 1:50–1:200 |
| 면역원 서열 | GNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQE |
| UniProt 수납 번호 | O95843 |
| 배송 상태 | Wet ice |
| 저장 온도 | −20 °C |
Gene Information
Gene: GUCA1C (human, Gene ID: 9626)
Guanylate cyclase activator 1C (GUCA1C), also known as guanylate cyclase activating protein 3 (GCAP3), is encoded by the gene mapped to human chromosome 3q13.1.
The encoded protein belongs to the EF-hand superfamily of Ca²⁺ binding proteins.
GUCA1C consists of four EF motifs: EF1 and EF2 form the N-terminal domain, while EF3 and EF4 form the C-terminal domain.
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



