CacheBy
Merck Anti-CENPE antibody produced in rabbit
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Merck Anti-CENPE antibody produced in rabbit

상품 한눈에 보기

Rabbit에서 생산된 Anti-CENPE 항체로 인간 CENPE 단백질을 인식합니다. Prestige Antibodies® 라인 제품이며, 면역형광 및 면역조직화학에 적합합니다. 비결합형 폴리클로날 항체로, −20°C에서 보관합니다.

브랜드
Merck Sigma

Merck Sigma · Merck Anti-CENPE antibody produced in rabbit

Anti-CENPE antibody produced in rabbit

제품 개요

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution.
Anti-Centromere protein E (CENPE, 312 kDa, Anti-Kif10) 항체입니다.

생물학적 정보

  • 생물학적 소스: Rabbit
  • 클론: Polyclonal
  • 결합: Unconjugated
  • 항체 형태: Affinity isolated antibody
  • 제품 라인: Prestige Antibodies® Powered by Atlas Antibodies
  • Form: Buffered aqueous glycerol solution
  • Species Reactivity: Human
  • Antibody Product Type: Primary antibodies

스펙 정보

항목 내용
포장 Small pack of 25 μL
Technique(s) Immunofluorescence: 0.25–2 μg/mL
Immunohistochemistry: 1:1000–1:2500
면역원 서열 EKIENLTRMLVTSSSLTLQQELKAKRKRRVTWCLGKINKMKNSNYADQFNIPTNITTKTHKLSINLLREIDESVCSESDVFSNTLDTLSEIEWNPATKLLNQENIESELNSLRADYDN
UniProt 수납 번호 Q02224
배송 상태 Wet ice
저장 온도 −20°C
Quality Level 100

유전자 정보

Human CENPE (Centromere protein E) [Gene ID: 1062]
The gene CENPE (centromere protein E) is mapped to human chromosome 4q24. The encoded protein belongs to the kinesin-7 family of proteins. The CENPE protein is present with spindle microtubules. The protein has a catalytic motor domain, a discontinuous α-helical coiled-coil domain, and an ATP-independent microtubule-interacting domain.

Merck Sigma 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.