AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-POP4 antibody produced in rabbit
상품 한눈에 보기
Rabbit에서 생산된 Anti-POP4 폴리클로날 항체로, Prestige Antibodies® Powered by Atlas Antibodies 제품입니다. 인간 POP4 단백질에 반응하며, immunoblotting 및 immunohistochemistry에 적합합니다. −20°C에서 보관하며, buffered glycerol 용액 형태로 제공됩니다.
- 브랜드
- Merck Sigma
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 01. 28. 오후 05:41
카탈로그 번호 · 상품 설명출고판매가담기
Merck HPA042748-100UL Anti-POP4 antibody produced in rabbit, 100uL pk판매 단위 pk ·
재고 확인 필요
920,800원VAT 포함 1,012,880원
Merck Sigma · Merck Anti-POP4 antibody produced in rabbit
Anti-POP4 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies 시리즈의 rabbit 유래 Anti-Processing Of Precursor 4 (POP4) 항체입니다.
Ribonuclease P/MRP Subunit (S. cerevisiae), Anti-RPP29에 대한 폴리클로날 항체로, buffered aqueous glycerol solution 형태로 제공됩니다.
생물학적 정보
- Biological Source: Rabbit
- Antibody Type: Primary antibody
- Clone Type: Polyclonal
- Conjugation: Unconjugated
- Form: Buffered aqueous glycerol solution
- Species Reactivity: Human
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
포장
- Small pack of 25 μL
실험 적용
| Technique | Recommended Dilution / Concentration |
|---|---|
| Immunoblotting | 0.04–0.4 μg/mL |
| Immunohistochemistry | 1:20–1:50 |
면역원 서열
KKKKAKGLSARQRRELRLFDIKPEQQRYSLFLPLHELWKQYIRDLCSGLKPDTQPQMIQAKLLKADLHGAIUniProt 정보
- Accession Number: O95707
품질 및 저장 조건
| 항목 | 내용 |
|---|---|
| Quality Level | 100 |
| Shipping Condition | Wet ice |
| Storage Temperature | −20°C |
추가 정보
Processing of precursor 4, ribonuclease P/MRP subunit (S. cerevisiae) recombinant protein epitope signature tag (PrEST)
Merck Sigma 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.