
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Merck Anti-LRRIQ1 antibody produced in rabbit
상품 한눈에 보기
토끼에서 생산된 Anti-LRRIQ1 폴리클로날 항체로 인간 단백질에 반응합니다. Prestige Antibodies® 제품군으로 높은 품질의 친화 정제 항체입니다. 면역조직화학(IHC)에 적합하며 −20°C에서 보관합니다.
- 브랜드
- Merck Sigma
Merck Sigma · Merck Anti-LRRIQ1 antibody produced in rabbit
Anti-LRRIQ1 antibody produced in rabbit
제품 개요
Prestige Antibodies® Powered by Atlas Antibodies
Affinity isolated antibody, buffered aqueous glycerol solution
Anti-FLJ12303, Anti-KIAA1801, Anti-Leucine-Rich Repeats And IQ Motif Containing 1
생물학적 소스
rabbit
품질 등급
100 (M-Clarity Program)
결합 형태
unconjugated
항체 형태
affinity isolated antibody
항체 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
제형
buffered aqueous glycerol solution
반응 종
human
포장
antibody small pack of 25 μL
적용 기술
- Immunohistochemistry (IHC): 1:20–1:50
면역원 서열
ATPDFVPEPSPHDLPMDEHVLPDDADINFGYCEVEEKCRQSFEAWQEKQKELEDKEKQTLKAQRDREEKQFQEEEEKR
UniProt 번호
배송 상태
wet ice
저장 온도
−20°C
유전자 정보
human LRRIQ1 (84125)
Leucine-rich repeats and IQ motif containing 1 recombinant protein epitope signature tag (PrEST)
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Biological Source | Rabbit |
| Quality Level | 100 |
| Conjugate | Unconjugated |
| Form | Buffered aqueous glycerol solution |
| Clone | Polyclonal |
| Species Reactivity | Human |
| Application | Immunohistochemistry (1:20–1:50) |
| Packaging | 25 μL |
| Storage Temperature | −20°C |
| Shipping Condition | Wet ice |
Merck Sigma 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



